Antibodies

Jump to Filters
View as table Download
BTG2 Rabbit Polyclonal Antibody
TA321783

USD 380.00

4 Weeks

Anti-BTG2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
BTG2 Rabbit Polyclonal Antibody
TA321784

USD 380.00

2 Weeks

Anti-BTG2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
BTG2 (N-term) Rabbit Polyclonal Antibody
AP50404PU-N

USD 580.00

2 Weeks

BTG2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 40-69 amino acids from the N-terminal region of human BTG2
BTG2 Rabbit Polyclonal Antibody
TA310107

USD 360.00

In Stock

Rabbit anti-BTG2 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
BTG2 Rabbit Polyclonal Antibody
TA333912

USD 539.00

5 Days

Rabbit Polyclonal Anti-BTG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the N terminal of human BTG2. Synthetic peptide located within the following region: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY
BTG2 Rabbit Polyclonal Antibody
TA333913

USD 539.00

5 Days

Rabbit Polyclonal Anti-BTG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the middle region of human BTG2. Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV