Antibodies

Jump to Filters
View as table Download
ACTN3 (N-term) Rabbit Polyclonal Antibody
AP23644PU-N

USD 535.00

2 Weeks

ACTN3 (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ACTN3 antibody was raised against synthetic peptide - KLH conjugated
ACTN3 (Center) Rabbit Polyclonal Antibody
AP50072PU-N

USD 580.00

2 Weeks

ACTN3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 408-437 amino acids from the Central region of human ACTN3
ACTN3 Rabbit Polyclonal Antibody
TA313420

USD 380.00

In Stock

Rabbit polyclonal anti-ACTN3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN3.
ACTN3 Rabbit Polyclonal Antibody
TA323240

USD 380.00

In Stock

Anti-ACTN3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-261 amino acids of human actinin, alpha 3
ACTN3 Rabbit Polyclonal Antibody
TA323241

USD 380.00

In Stock

Anti-ACTN3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-261 amino acids of human actinin, alpha 3
ACTN3 Rabbit Polyclonal Antibody
TA346275

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACTN3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY