Antibodies

Jump to Filters
View as table Download
RPS8 Rabbit Polyclonal Antibody
TA314487

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPS8 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPS8.
RPS8 Rabbit Polyclonal Antibody
TA336113

USD 539.00

5 Days

Rabbit Polyclonal Anti-Rps8 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rps8 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rps8. Synthetic peptide located within the following region: KKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELE