PDE8A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Dog, Gorilla, Human, Pig, Rabbit, Gibbon, Horse (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | PDE8A antibody was raised against synthetic 16 amino acid peptide from near N-terminus of human PDE8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Panda, Horse, Rabbit, Pig (100%); Marmoset (94%); Mouse, Rat, Bovine, Elephant, Opossum (88%); Platypus, Zebrafish (81%). |
Rabbit Polyclonal Anti-PDE8A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE8A antibody: synthetic peptide directed towards the C terminal of human PDE8A. Synthetic peptide located within the following region: VSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPK |
Rabbit Polyclonal Anti-PDE8A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE8A antibody: synthetic peptide directed towards the C terminal of human PDE8A. Synthetic peptide located within the following region: SSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH |
Germany
Japan
United Kingdom
China