Antibodies

Jump to Filters
View as table Download
AMPD2 (Center) Rabbit Polyclonal Antibody
AP50165PU-N

USD 580.00

2 Weeks

AMPD2 (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 194~224 amino acids from the Center region of human AMPD2
AMPD2 Rabbit Polyclonal Antibody
TA313450

USD 380.00

4 Weeks

Rabbit polyclonal anti-AMPD2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AMPD2.
AMPD2 Rabbit Polyclonal Antibody
TA338196

USD 539.00

5 Days

Rabbit Polyclonal Anti-AMPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMPD2 antibody is: synthetic peptide directed towards the N-terminal region of Human AMPD2. Synthetic peptide located within the following region: VVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSA
AMPD2 Rabbit Polyclonal Antibody
TA358754

USD 539.00

5 Days

AMPD2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
AMPD2 Rabbit Polyclonal Antibody
TA361534

USD 539.00

5 Days

AMPD2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human AMPD2
AMPD2 Rabbit Polyclonal Antibody
TA362145

USD 539.00

5 Days

AMPD2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human AMPD2