AMPD2 (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 194~224 amino acids from the Center region of human AMPD2 |
AMPD2 (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 194~224 amino acids from the Center region of human AMPD2 |
Rabbit polyclonal anti-AMPD2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AMPD2. |
Rabbit Polyclonal Anti-AMPD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AMPD2 antibody is: synthetic peptide directed towards the N-terminal region of Human AMPD2. Synthetic peptide located within the following region: VVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSA |
AMPD2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
AMPD2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human AMPD2 |
AMPD2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human AMPD2 |