Antibodies

Jump to Filters
View as table Download
OR6C70 Rabbit Polyclonal Antibody
TA316437

USD 380.00

In Stock

Rabbit polyclonal anti-OR6C70 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR6C70.
OR6C70 Rabbit Polyclonal Antibody
TA336170

USD 485.00

5 Days

Rabbit Polyclonal Anti-OR6C70 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR6C70 Antibody: synthetic peptide directed towards the C terminal of human OR6C70. Synthetic peptide located within the following region: GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK