Antibodies

View as table Download

Rabbit Polyclonal Anti-ATP6V1B2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the middle region of human ATP6V1B2. Synthetic peptide located within the following region: NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

Rabbit Polyclonal Anti-ATP6V1B2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the N terminal of human ATP6V1B2. Synthetic peptide located within the following region: VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG