Antibodies

Jump to Filters
View as table Download
FGF16 Rabbit Polyclonal Antibody
TA351187

USD 380.00

In Stock

Rabbit Polyclonal Anti-FGF16 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF16
FGF16 (N-term) Rabbit Polyclonal Antibody
AP51654PU-N

USD 580.00

2 Weeks

FGF16 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human FGF16
FGF16 Rabbit Polyclonal Antibody
TA338201

USD 539.00

5 Days

Rabbit Polyclonal Anti-FGF16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF16 antibody is: synthetic peptide directed towards the C-terminal region of Human FGF16. Synthetic peptide located within the following region: REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH