Antibodies

Jump to Filters
View as table Download
HAO1 Rabbit Polyclonal Antibody
AP18044PU-N

USD 580.00

2 Weeks

HAO1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human HAO1
HAO1 Rabbit Polyclonal Antibody
TA344134

USD 539.00

5 Days

Rabbit Polyclonal Anti-HAO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAO1 antibody: synthetic peptide directed towards the C terminal of human HAO1. Synthetic peptide located within the following region: GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV