GSTM5 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of Human GSTM5 |
GSTM5 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of Human GSTM5 |
Rabbit Polyclonal Anti-GSTM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTM5 antibody: synthetic peptide directed towards the N terminal of human GSTM5. Synthetic peptide located within the following region: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK |
GSTM5 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM5 |