Antibodies

Jump to Filters
View as table Download
ADH6 (Center) Rabbit Polyclonal Antibody
AP50091PU-N

USD 580.00

2 Weeks

ADH6 (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 217~247 amino acids from the Center region of human ADH6
ADH6 Rabbit Polyclonal Antibody
TA346214

USD 485.00

5 Days

Rabbit Polyclonal Anti-ADH6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID