Antibodies

View as table Download

Rabbit polyclonal Ephrin B1/B2/B3 (Tyr324) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Ephrin B1/B2/B3 around the phosphorylation site of tyrosine 324 (G-D-YP-G-H).
Modifications Phospho-specific

Rabbit Polyclonal EFNB1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human EFNB1/2

Ephrin B1 (EFNB1) (+Ephrin-B2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 300-340 of Human Ephrin-B1.

Ephrin B1 (EFNB1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-EFNB1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFNB1 antibody: synthetic peptide directed towards the middle region of human EFNB1. Synthetic peptide located within the following region: SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG

Rabbit anti Ephrin B1 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant full length (1-346aa) human Ephrin-B1 protein expressed in E.coli

Rabbit polyclonal Ephrin B1/B2 (Tyr329) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Ephrin B1/B2 around the phosphorylation site of tyrosine 329 (P-V-YP-I-V).
Modifications Phospho-specific