Antibodies

Jump to Filters
View as table Download
DCC Rabbit Polyclonal Antibody
TA350750

USD 380.00

In Stock

Rabbit Polyclonal Anti-DCC Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DCC
DCC (Center) Rabbit Polyclonal Antibody
AP51195PU-N

USD 580.00

2 Weeks

DCC (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 642-670 amino acids from the Central region of Human DCC.
DCC Rabbit Polyclonal Antibody
TA313747

USD 380.00

In Stock

Rabbit polyclonal anti-DCC antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DCC.
DCC Rabbit Polyclonal Antibody
TA339003

USD 539.00

5 Days

Rabbit Polyclonal Anti-DCC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCC antibody: synthetic peptide directed towards the middle region of human DCC. Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ
DCC Rabbit Polyclonal Antibody
TA354594

USD 425.00

5 Days

Rabbit anti DCC Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus (within 1380-1447aa) of Human DCC protein.