Antibodies

Jump to Filters
View as table Download
CACNG7 Rabbit Polyclonal Antibody
TA315693

USD 380.00

4 Weeks

Rabbit polyclonal anti-CACNG7 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CACNG7.
CACNB2 Rabbit Polyclonal Antibody
TA338803

USD 539.00

5 Days

Rabbit Polyclonal Anti-Cacnb2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cacnb2 antibody is: synthetic peptide directed towards the middle region of Rat Cacnb2. Synthetic peptide located within the following region: DFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ
COX4 (COX4I2) Rabbit Polyclonal Antibody
TA347727

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-COX42 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX42 Antibody: A synthesized peptide derived from human COX42
Cytochrome C Oxidase subunit VIc (COX6C) Rabbit Polyclonal Antibody
TA347778

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-COX6C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C
COX4 (COX4I1) Rabbit Polyclonal Antibody
TA348031

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-COX IV antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX IV antibody: A synthesized peptide derived from human COX IV
Cardiac Troponin I (TNNI3) Rabbit Polyclonal Antibody
TA354523

USD 395.00

5 Days

Rabbit anti Troponin I Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to inter-segment of human Troponin I Cardiac isoform protein.