Antibodies

Jump to Filters
View as table Download
SOX10 Rabbit Polyclonal Antibody
TA333906

USD 539.00

5 Days

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
SOX10 Rabbit Polyclonal Antibody
TA355017

USD 570.00

2 Weeks

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SOX10 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human SOX10.
SOX10 Rabbit Polyclonal Antibody
TA381887

USD 365.00

3 Weeks

SOX10 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SOX10 (NP_008872.1).
Modifications Unmodified
SOX10 Rabbit Polyclonal Antibody
TA381888

USD 365.00

3 Weeks

SOX10 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic Peptide of human SOX10
Modifications Unmodified