BEST4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Gorilla, Human, Pig, Rabbit, Gibbon (Predicted: Monkey, Rat, Horse) |
| Conjugation | Unconjugated |
| Immunogen | BEST4 antibody was raised against synthetic 18 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Bat, Rabbit, Pig (100%); Marmoset, Rat, Horse (94%); Dog (89%); Panda, Lizard (83%). |
BEST4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Gibbon (Predicted: Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | BEST4 antibody was raised against synthetic 15 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rabbit (93%); Hamster (87%); Pig (80%). |
Rabbit Polyclonal Anti-VMD2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VMD2L2 antibody: synthetic peptide directed towards the N terminal of human VMD2L2. Synthetic peptide located within the following region: MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY |
Germany
Japan
United Kingdom
China
