Rabbit Polyclonal Anti-PPP1R8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the N terminal of human PPP1R8. Synthetic peptide located within the following region: THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD |
Rabbit Polyclonal Anti-PPP1R8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the middle region of human PPP1R8. Synthetic peptide located within the following region: PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK |
Rabbit polyclonal anti-PPP1R8 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP1R8. |
Rabbit Polyclonal Anti-PPP1R8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the N terminal of human PPP1R8. Synthetic peptide located within the following region: DKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVF |
Rabbit Polyclonal Anti-PPP1R8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the middle region of human PPP1R8. Synthetic peptide located within the following region: VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY |
Germany
Japan
United Kingdom
China
