THTPA rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human THTPA |
THTPA rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human THTPA |
THTPA rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human THTPA |
Rabbit Polyclonal Anti-THTPA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THTPA antibody is: synthetic peptide directed towards the N-terminal region of Human THTPA. Synthetic peptide located within the following region: KFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDS |