Antibodies

Jump to Filters
View as table Download
RPL11 Rabbit Polyclonal Antibody
TA350369

USD 380.00

In Stock

Rabbit Polyclonal Anti-RPL11 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPL11
RPL11 Rabbit Polyclonal Antibody
TA381034

USD 365.00

3 Weeks

RPL11 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human RPL11 (NP_001186731.1).
Modifications Unmodified
RPL11 Rabbit Polyclonal Antibody
TA314458

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPL11 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human RPL11.
RPL11 Rabbit Polyclonal Antibody
TA338284

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPL11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL11 antibody is: synthetic peptide directed towards the C-terminal region of Human RPL11. Synthetic peptide located within the following region: DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK