Antibodies

Jump to Filters
View as table Download
PRPF8 Rabbit Polyclonal Antibody
TA368078

USD 380.00

4 Weeks

PRPF8 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRPF8
PRPF8 Rabbit Polyclonal Antibody
TA372316

USD 380.00

4 Weeks

PRPF8 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRPF8
PRPF8 Rabbit Polyclonal Antibody
TA380411

USD 365.00

3 Weeks

PRPF8 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRPF8 (NP_006436.3).
Modifications Unmodified
PRPF8 Rabbit Polyclonal Antibody
TA345964

USD 539.00

5 Days

Rabbit Polyclonal Anti-PRPF8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF8 antibody: synthetic peptide directed towards the N terminal of human PRPF8. Synthetic peptide located within the following region: SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR