Antibodies

View as table Download

Rabbit Polyclonal Anti-NEDD4L Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NEDD4L

Rabbit Polyclonal Anti-NEDD4L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEDD4L antibody: synthetic peptide directed towards the middle region of human NEDD4L. Synthetic peptide located within the following region: TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP