Antibodies

Jump to Filters
View as table Download
JNK2 (MAPK9) Rabbit Polyclonal Antibody
TA322063

USD 380.00

In Stock

Anti-MAPK9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 373-386 amino acids of Human mitogen-activated protein kinase 9
JNK2 (MAPK9) Rabbit Polyclonal Antibody
TA322064

USD 380.00

4 Weeks

Anti-MAPK9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 373-386 amino acids of Human mitogen-activated protein kinase 9
JNK2 (MAPK9) Rabbit Polyclonal Antibody
TA327027

USD 450.00

3 Weeks

Rabbit anti-JNK2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen C term -peptide of human JNK2
JNK2 (MAPK9) Rabbit Polyclonal Antibody
TA344631

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL