Antibodies

View as table Download

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA