Rabbit Polyclonal Anti-RPL10A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL10A antibody: synthetic peptide directed towards the middle region of human RPL10A. Synthetic peptide located within the following region: YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK |
Rabbit Polyclonal Anti-RPL10A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL10A antibody: synthetic peptide directed towards the N terminal of human RPL10A. Synthetic peptide located within the following region: MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS |
Germany
Japan
United Kingdom
China