Antibodies

Jump to Filters
View as table Download
PIAS2 Rabbit Polyclonal Antibody
TA350895

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS2
PIAS2 Rabbit Polyclonal Antibody
TA319767

USD 570.00

5 Days

Rabbit Polyclonal PIAS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2.
PIAS2 Rabbit Polyclonal Antibody
TA312167

USD 380.00

In Stock

Rabbit polyclonal anti-PIAS2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS2.
PIAS2 Rabbit Polyclonal Antibody
TA341797

USD 539.00

5 Days

Rabbit Polyclonal Anti-Pias2 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE
PIAS2 Rabbit Polyclonal Antibody
TA332818

USD 365.00

3 Weeks

Rabbit anti-PIAS2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PIAS2
PIAS2 Rabbit Polyclonal Antibody
TA347490

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 Antibody: A synthesized peptide derived from human PIAS2