Antibodies

Jump to Filters
View as table Download
FUT8 Rabbit Polyclonal Antibody
TA351201

USD 380.00

Backordered

Rabbit Polyclonal Anti-FUT8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUT8
Ribophorin I (RPN1) Rabbit Polyclonal Antibody
TA349562

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-RPN1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPN1
CDw75 (ST6GAL1) Rabbit Polyclonal Antibody
TA314536

USD 380.00

In Stock

Rabbit polyclonal anti-ST6GAL1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ST6GAL1.
B4GALT3 Rabbit Polyclonal Antibody
TA314795

USD 380.00

In Stock

Rabbit polyclonal anti-B4GALT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.
CDw75 (ST6GAL1) Rabbit Polyclonal Antibody
AP31619PU-N

USD 535.00

2 Weeks

CDw75 (ST6GAL1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the Internal region of Human ST6GAL1.
alpha Glucosidase II (GANAB) Rabbit Polyclonal Antibody
TA308533

USD 625.00

5 Days

Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Monkey, Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697)
TUSC3 Rabbit Polyclonal Antibody
TA312791

USD 380.00

4 Weeks

Rabbit polyclonal anti-TUSC3 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TUSC3.
ALG6 Rabbit Polyclonal Antibody
TA350848

USD 380.00

In Stock

Rabbit Polyclonal Anti-ALG6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALG6
ALG8 Rabbit Polyclonal Antibody
TA335475

USD 539.00

5 Days

Rabbit Polyclonal Anti-Alg8 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Alg8 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF
TUSC3 Rabbit Polyclonal Antibody
TA347683

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TUSC3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TUSC3 Antibody: A synthesized peptide derived from human TUSC3