Antibodies

Jump to Filters
View as table Download
GALNT6 Rabbit Polyclonal Antibody
TA341885

USD 485.00

5 Days

Rabbit Polyclonal Anti-GALNT6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the N terminal of human GALNT6. Synthetic peptide located within the following region: MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP
GALNT6 Rabbit Polyclonal Antibody
TA341884

USD 539.00

5 Days

Rabbit Polyclonal Anti-GALNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the middle region of human GALNT6. Synthetic peptide located within the following region: EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN