Antibodies

Jump to Filters
View as table Download
SCF (KITLG) Rabbit Polyclonal Antibody
TA306779

USD 570.00

2 Weeks

Rabbit Polyclonal SCF Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF.
SCF (KITLG) Rabbit Polyclonal Antibody
TA335261

USD 539.00

5 Days

Rabbit Polyclonal Anti-KITLG Antibody

Applications WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
SCF (KITLG) Rabbit Polyclonal Antibody
TA347853

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-SCF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCF Antibody: Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF.