Antibodies

Jump to Filters
View as table Download
VPS25 Rabbit Polyclonal Antibody
TA350606

USD 380.00

In Stock

Rabbit Polyclonal Anti-VPS25 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
VPS25 Rabbit Polyclonal Antibody
TA342975

USD 539.00

5 Days

Rabbit Polyclonal Anti-VPS25 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Vps25 antibody is: synthetic peptide directed towards the C-terminal region of Rat Vps25. Synthetic peptide located within the following region: LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF