Antibodies

View as table Download

Rabbit Polyclonal Anti-TEX264 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TEX264 antibody: synthetic peptide directed towards the middle region of human TEX264. Synthetic peptide located within the following region: SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV

Rabbit Polyclonal Anti-TEX264 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TEX264 antibody: synthetic peptide directed towards the middle region of human TEX264. Synthetic peptide located within the following region: GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK