Rabbit Polyclonal Anti-LAPTM4B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAPTM4B antibody: synthetic peptide directed towards the middle region of human LAPTM4B. Synthetic peptide located within the following region: YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS |
Rabbit Polyclonal Anti-LAPTM4B Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Laptm4b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Laptm4b. Synthetic peptide located within the following region: SCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVPSTAKEPPPPYVSA |
Germany
Japan
United Kingdom
China
