Antibodies

Jump to Filters
View as table Download
CYP8B1 Rabbit Polyclonal Antibody
TA313734

USD 380.00

2 Weeks

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.
LOX 1 (OLR1) Rabbit Polyclonal Antibody
TA321497

USD 380.00

4 Weeks

Anti-OLR1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human oxidized low density lipoprotein (lectin-like) receptor 1
ACSL3 Rabbit Polyclonal Antibody
TA339415

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
FACL4 (ACSL4) Rabbit Polyclonal Antibody
TA324720

USD 580.00

2 Weeks

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).
ACSL1 Rabbit Polyclonal Antibody
TA331164

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACSL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1. Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
FACL4 (ACSL4) Rabbit Polyclonal Antibody
TA349566

USD 380.00

In Stock

Rabbit Polyclonal Anti-ACSL4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACSL4
LOX 1 (OLR1) Rabbit Polyclonal Antibody
TA349624

USD 380.00

In Stock

Rabbit Polyclonal Anti-OLR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OLR1
CD36 Rabbit Polyclonal Antibody
TA301400

USD 620.00

2 Weeks

Rabbit Polyclonal Antibody against CD36

Applications ICC/IF, IHC, WB
Reactivities Human, Bovine, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to a region of human CD36 between residues 100-200.
FATP2 (SLC27A2) Rabbit Polyclonal Antibody
TA333990

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC27A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC27A2 Antibody: synthetic peptide directed towards the N terminal of human SLC27A2. Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
FATP1 (SLC27A1) Rabbit Polyclonal Antibody
TA321973

USD 380.00

In Stock

Anti-SLC27A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 630-646 amino acids of human solute carrier family 27 (fatty acid transporter), member 1
FATP2 (SLC27A2) Rabbit Polyclonal Antibody
TA350424

USD 380.00

In Stock

Rabbit Polyclonal Anti-SLC27A2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SLC27A2
CD36 Rabbit Polyclonal Antibody
TA301401

USD 550.00

5 Days

Rabbit Polyclonal Antibody against CD36

Applications FC, ICC/IF, IHC, Immunoblotting, SDS-PAGE, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to a region of human CD36 between residues 300-400.
FATP1 (SLC27A1) Rabbit Polyclonal Antibody
TA321972

USD 380.00

In Stock

Anti-SLC27A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 630-646 amino acids of human solute carrier family 27 (fatty acid transporter), member 1
CPT1A Rabbit Polyclonal Antibody
TA323383

USD 380.00

In Stock

Anti-CPT1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human carnitine palmitoyltransferase 1A (liver)
CPT1B Rabbit Polyclonal Antibody
TA339410

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CPT1B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA