Antibodies

Jump to Filters
View as table Download
OR56B1 Rabbit Polyclonal Antibody
TA316401

USD 380.00

In Stock

Rabbit polyclonal anti-OR56B1 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR56B1.
OR56B1 Rabbit Polyclonal Antibody
TA332295

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR56B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR56B1 Antibody is: synthetic peptide directed towards the middle region of Human OR56B1. Synthetic peptide located within the following region: ILKATLFMVLRNGLFVTPVPVLAAQRDYCSKNEIEHCLCSNLGVTSLACD