Antibodies

Jump to Filters
View as table Download
BAX Rabbit Polyclonal Antibody
TA590174

USD 482.00

In Stock

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
BCL2 Rabbit Monoclonal Antibody [Clone ID: OTIR1C12]
TA592344

USD 379.00

2 Weeks

BCL2 Rabbit monoclonal antibody,clone OTIR1C12

Applications IHC
Reactivities Human
Conjugation Unconjugated
BCL2 Rabbit Monoclonal Antibody [Clone ID: OTIR1H2]
TA592345

USD 379.00

2 Weeks

BCL2 Rabbit monoclonal antibody,clone OTIR1H2

Applications IHC
Reactivities Human
Conjugation Unconjugated
BCL2 Rabbit Monoclonal Antibody [Clone ID: OTIR3F2]
TA592348

USD 379.00

2 Weeks

BCL2 Rabbit monoclonal antibody,clone OTIR3F2

Applications IHC
Reactivities Human
Conjugation Unconjugated
BDNF Rabbit Polyclonal Antibody
TA319152

USD 765.00

In Stock

Rabbit polyclonal anti-BDNF antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli.
BAX Rabbit Polyclonal Antibody
TA890001

USD 407.00

In Stock

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.
BAX Rabbit Polyclonal Antibody
TA321642

USD 380.00

4 Weeks

Anti-BAX Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein
BCL2 Rabbit Polyclonal Antibody
TA323608

USD 380.00

2 Weeks

Anti-BCL2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-54 amino acids of Human B-cell CLL/lymphoma 2
BDNF Rabbit Polyclonal Antibody
TA346304

USD 539.00

5 Days

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Sortilin (SORT1) Rabbit Polyclonal Antibody
TA351744

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-SORT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SORT1
BAX Rabbit Polyclonal Antibody
TA890001S

USD 188.00

In Stock

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA306424

USD 570.00

In Stock

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.
TrkA (NTRK1) Rabbit Polyclonal Antibody
TA322998

USD 380.00

In Stock

Anti-NTRK1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 781-796 amino acids of human neurotrophic tyrosine kinase, receptor, type 1
TrkA (NTRK1) Rabbit Polyclonal Antibody
TA322999

USD 380.00

In Stock

Anti-NTRK1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 781-796 amino acids of human neurotrophic tyrosine kinase, receptor, type 1
BDNF Rabbit Polyclonal Antibody
TA323909

USD 380.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 153-168 amino acids of Human brain-derived neurotrophic factor