Rabbit Polyclonal Anti-EPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPO antibody: synthetic peptide directed towards the middle region of human EPO. Synthetic peptide located within the following region: KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Rabbit Polyclonal Anti-EPO Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPO Antibody: A synthesized peptide derived from human EPO |
Germany
Japan
United Kingdom
China