Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal Anti-FLI1 Antibody
| Applications | WB |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP |
EIF4EBP2 (99-120) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Bovine, Canine, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | EIF4EBP2 antibody was raised against human PHAS-II synthetic peptide (residues 99-120) was synthesized and the peptide coupled to KLH. |
TAF10 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish, African clawed frog |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the C terminal of human TAF10 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Porcine
Antibody Hosts
- Rabbit
Families
- Transcription Factors