Germany
Japan
United Kingdom
China
Rabbit Polyclonal LIM1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Bovine, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal antibody to ARA9 (aryl hydrocarbon receptor interacting protein)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Monkey, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 330 of ARA9 (Uniprot ID#O00170) |
Rabbit polyclonal STAT2 phospho Y690 antibody
| Applications | IHC, WB |
| Reactivities | Human, Chimpanzee, Macaque, Monkey, Rat, Dog, Pig, Mouse, Bovine, Horse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein. |
Rabbit polyclonal Phospho-p53(T18) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Monkey, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 Antibody (S315)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53. |
Rabbit Polyclonal Anti-RAB8A Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB8A antibody: synthetic peptide directed towards the middle region of human RAB8A. Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP |
HNF4G / HNF4 Gamma Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Gibbon (Predicted: Monkey, Mouse, Dog) |
| Conjugation | Unconjugated |
| Immunogen | HNF4G / HNF4 Gamma antibody was raised against synthetic 16 amino acid peptide from internal region of human HNF4G. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Elephant, Panda, Dog (94%); Bat, Horse, Turkey, Chicken (88%); Rat, Pig, Opossum, Platypus (81%). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Monkey
Antibody Hosts
- Rabbit
Families
- Transcription Factors
Filter by
Target Symbol
- P53 (4)
- NON NEURONAL ENOLASE (2)
- NR2E3 (2)
- OCT4 (2)
- ARA9 (1)
- C FOS (1)
- CALRETICULIN (1)
- ESTROGEN RELATED RECEPTOR BETA (1)
- HDAC2 (1)
- HIF-1 ALPHA (1)
- HNF4 GAMMA (1)
- ING1 (1)
- KCNH2 (1)
- LIM1 (1)
- LXR ALPHA (1)
- MCM6 (1)
- NUR77 (1)
- PTGER3 (1)
- RAB8A (1)
- RAP1 (1)
- ROR BETA (1)
- SOD2 (1)
- STAT2 (1)
- TATA BINDING PROTEIN (1)
- TNFRSF1A (1)
Applications
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Huntington's disease (7)
- MAPK signaling pathway (7)
- Pathways in cancer (7)
- Cell cycle (6)
- Amyotrophic lateral sclerosis (ALS) (5)
- Apoptosis (5)
- Chronic myeloid leukemia (5)
- Colorectal cancer (5)
- Basal cell carcinoma (4)
- Bladder cancer (4)
- Endometrial cancer (4)
- Glioma (4)
- Melanoma (4)
- Neurotrophin signaling pathway (4)
- Non-small cell lung cancer (4)
- Pancreatic cancer (4)
- Prostate cancer (4)
- Small cell lung cancer (4)
- Thyroid cancer (4)
- Wnt signaling pathway (4)
- p53 signaling pathway (4)
- Glycolysis / Gluconeogenesis (2)
- Metabolic pathways (2)
- RNA degradation (2)
- Adipocytokine signaling pathway (1)
- Alzheimer's disease (1)
- Antigen processing and presentation (1)
- B cell receptor signaling pathway (1)
- Basal transcription factors (1)
- Calcium signaling pathway (1)
- Chemokine signaling pathway (1)
- Cytokine-cytokine receptor interaction (1)
- DNA replication (1)
- Jak-STAT signaling pathway (1)
- Maturity onset diabetes of the young (1)
- Neuroactive ligand-receptor interaction (1)
- Notch signaling pathway (1)
- PPAR signaling pathway (1)
- Renal cell carcinoma (1)
- T cell receptor signaling pathway (1)
- Toll-like receptor signaling pathway (1)
- mTOR signaling pathway (1)