Antibodies

Jump to Filters
View as table Download
FOXA3 Rabbit Polyclonal Antibody
TA329710

USD 539.00

5 Days

Rabbit Polyclonal Anti-FOXA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA3 antibody: synthetic peptide directed towards the middle region of human FOXA3. Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
FOXA3 Rabbit Polyclonal Antibody
TA354728

USD 425.00

5 Days

Rabbit anti FOXA3 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human FOXA3 protein. This sequence is identical to rat, mouse and human origins.