Germany
Japan
United Kingdom
China
Rabbit Polyclonal MDM2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2. |
Antibodies
View as table Download
Rabbit Polyclonal p53 (Ser46) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human p53 around the phosphorylation site of Sersine 46. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ZMAT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZMAT3 antibody: synthetic peptide directed towards the N terminal of human ZMAT3. Synthetic peptide located within the following region: EQDCALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSC |
Rabbit Polyclonal Anti-p73 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p73 Antibody: A synthesized peptide derived from human p73 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-ATM(Phospho-Ser1981) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATM(Phospho-Ser1981) Antibody: Peptide sequence around phosphorylation site of serine 1981 (E-G-S(p)-Q-S) derived from Human ATM. |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 (Phospho-Thr387) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 (Phospho-Ser46) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 46. |
| Modifications | Phospho-specific |
p53 (TP53) pSer392 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within p53 which includes phosphorylated Ser392. |
Rabbit anti Cyclin E Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human Cyclin E protein. The sequence is identical to human, mouse. |
Rabbit anti p73 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Transcription Factors
Pathways
- p53 signaling pathway