Antibodies

Jump to Filters
View as table Download
HPRT (HPRT1) Rabbit Polyclonal Antibody
TA332846

USD 450.00

3 Weeks

Rabbit anti-HPRT1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HPRT1
HPRT (HPRT1) Rabbit Polyclonal Antibody
TA346669

USD 539.00

5 Days

Rabbit Polyclonal Anti-HPRT1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK