Rabbit polyclonal MBD2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This MBD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-279 amino acids from the Central region of human MBD2. |
Rabbit Polyclonal MBD2 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD2 antibody: mouse MBD2 (methyl-CpG binding domain protein 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein |
Rabbit Polyclonal Anti-MBD2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the N terminal of human MBD2. Synthetic peptide located within the following region: RAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRR |
Rabbit Polyclonal Anti-MBD2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the middle region of human MBD2. Synthetic peptide located within the following region: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT |
Germany
Japan
United Kingdom
China
