Antibodies

Jump to Filters
View as table Download
IGFBP7 Rabbit Polyclonal Antibody
TA323151

USD 380.00

In Stock

Anti-IGFBP7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 270-282 amino acids of Human insulin-like growth factor binding protein 7
IGFBP7 Rabbit Polyclonal Antibody
TA323150

USD 380.00

In Stock

Anti-IGFBP7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 270-282 amino acids of Human insulin-like growth factor binding protein 7
IGFBP7 Rabbit Polyclonal Antibody
TA346551

USD 539.00

5 Days

Rabbit Polyclonal Anti-IGFBP7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IGFBP7 antibody: synthetic peptide directed towards the C terminal of human IGFBP7. Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH