Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit Polyclonal Gastrokine 1 Antibody
| Applications | WB |
| Reactivities | Human, Equine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen. |
Germany
Japan
United Kingdom
China
