Antibodies

Jump to Filters
View as table Download
FGF14 Rabbit Polyclonal Antibody
TA335069

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-FGF14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF14 antibody: synthetic peptide directed towards the middle region of human FGF14. Synthetic peptide located within the following region: ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP
FGF14 Rabbit Polyclonal Antibody
TA360095

USD 539.00

5 Days

FGF14 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FGF14