Antibodies

Jump to Filters
View as table Download
BMP8A Rabbit Polyclonal Antibody
TA316388

USD 380.00

In Stock

Rabbit polyclonal anti-BMP8A antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human BMP8A.
BMP8A Rabbit Polyclonal Antibody
TA337727

USD 539.00

5 Days

Rabbit Polyclonal Anti-BMP8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the middle region of Human BMP8A. Synthetic peptide located within the following region: VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG
BMP8A Rabbit Polyclonal Antibody
TA337728

USD 539.00

5 Days

Rabbit Polyclonal Anti-BMP8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8A. Synthetic peptide located within the following region: RPPPGCPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPL
BMP8A Rabbit Polyclonal Antibody
TA358916

USD 539.00

5 Days

BMP8A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BMP8A