Rabbit Polyclonal Glutathione Peroxidase 3 Antibody
Applications | ICC/IF, IHC, Immunoblotting, WB |
Reactivities | Human, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | Full length human GPX3 protein [Swiss-Prot# P22352] expressed in E. coli. |
Rabbit Polyclonal Glutathione Peroxidase 3 Antibody
Applications | ICC/IF, IHC, Immunoblotting, WB |
Reactivities | Human, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | Full length human GPX3 protein [Swiss-Prot# P22352] expressed in E. coli. |
Rabbit Polyclonal Anti-GPX3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI |