Rabbit polyclonal IL-1 beta antibody
| Applications | WB |
| Reactivities | Human, Primate, Dog |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared by repeated immunizations with recombinant human IL-1β produced in E.coli. The MW of the recombinant 153 aa IL-1β was 17 kDa with the N-terminal amino acid at position alanine 117. This cleavage site is generated by the IL-1β converting enzyme (ICE, capase-1). |
Rabbit polyclonal MIP-1 beta antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human MIP-1β protein. |
Rabbit polyclonal IL-33 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Peroxidase |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein. |
Rabbit polyclonal IL-33 antibody Biotin Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein. |
Rabbit polyclonal anti-IL-6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with recombinant human IL-6 produced in E.coli. |
Rabbit polyclonal IFNA4 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4. |
Rabbit Polyclonal Anti-IFNA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IFNA7 Antibody: synthetic peptide directed towards the N terminal of human IFNA7. Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ |
Rabbit Polyclonal Anti-IFNA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5. Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY |
Rabbit Polyclonal Anti-IL6 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL6 antibody was raised against synthetic 18 amino acid peptide from internal region of human IL-6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%). |
Rabbit Polyclonal Anti-IFNA13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA13 antibody: synthetic peptide directed towards the C terminal of human IFNA13. Synthetic peptide located within the following region: ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
Rabbit Polyclonal Anti-IFNA16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA16 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA16. Synthetic peptide located within the following region: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD |
Rabbit Polyclonal Anti-IFNA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
IFNA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IFNA2 |
IFNA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IFNA2 |
Germany
Japan
United Kingdom
China