Antibodies

Jump to Filters
View as table Download
TrkC (NTRK3) Rabbit Polyclonal Antibody
TA339188

USD 539.00

5 Days

Rabbit Polyclonal Anti-NTRK3

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3. Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
TrkC (NTRK3) Rabbit Polyclonal Antibody
TA332952

USD 365.00

3 Weeks

Rabbit anti-NTRK3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NTRK3