Rabbit Polyclonal Anti-Myt1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP |
Rabbit Polyclonal Anti-TTK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TTK Antibody: A synthesized peptide derived from human TTK |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 Antibody: A synthesized peptide derived from human CDK7 |
Rabbit Polyclonal Anti-DNA-PK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNA-PK Antibody: A synthesized peptide derived from human DNA-PK |
Rabbit Polyclonal Anti-CDC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 Antibody: A synthesized peptide derived from human CDC2 |
Rabbit Polyclonal Anti-BUB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BUB1 Antibody: A synthesized peptide derived from human BUB1 |
Rabbit Polyclonal Anti-DNA PK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNA PK Antibody: A synthesized peptide derived from human DNA PK |
Rabbit Polyclonal Anti-ATM(Phospho-Ser1981) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATM(Phospho-Ser1981) Antibody: Peptide sequence around phosphorylation site of serine 1981 (E-G-S(p)-Q-S) derived from Human ATM. |
| Modifications | Phospho-specific |
Rabbit anti GSK3b(Paired S9) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -TTSFA- without phosphorylation of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species |
Rabbit anti GSK3b(pS9) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -TTSFA- with a phosphorylation site at Ser9 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species. |
Rabbit anti GSK-3b (pY216) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -NVSYI- with a phosphorylation site at Tyr216 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species. |
Rabbit anti GSK-3b (Paired Y216) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -NVSYI- without phosphorylation at Tyr216 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species |
Rabbit anti GSK-3b Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of GSK-3beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species. |
Germany
Japan
United Kingdom
China