Rabbit Polyclonal antibody to SET (SET nuclear oncogene)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Chicken, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of SET |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Germany
Japan
United Kingdom
China
